Basic Information | |
---|---|
Taxon OID | 3300005928 Open in IMG/M |
Scaffold ID | Ga0075105_1007481 Open in IMG/M |
Source Dataset Name | Saline lake microbial communities from Deep Lake, Antarctica - Antarctic Deep Lake Metagenome 02WF5 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1748 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Deep Lake, Antarctica | |||||||
Coordinates | Lat. (o) | -68.5627 | Long. (o) | 78.1882 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006880 | Metagenome | 362 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075105_10074813 | F006880 | N/A | LVHDFLSQQNNRLFLFLSELMDFFVAGRDQSAADQPNNLAEGHPQL* |
⦗Top⦘ |