NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075133_106278

Scaffold Ga0075133_106278


Overview

Basic Information
Taxon OID3300005925 Open in IMG/M
Scaffold IDGa0075133_106278 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome Rauer1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)659
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Haloferacalesvirus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameRauer Lake, Antarctica
CoordinatesLat. (o)-68.8136Long. (o)77.9341Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058558Metagenome135Y

Sequences

Protein IDFamilyRBSSequence
Ga0075133_1062783F058558GAGGMNINDKFRHRAFKAVVKTDDHDVAEHSIIAGLSWVGVNDGEYRMLWTRDHFNTSGHNHVSVIFIAPTEYMMDFPTLVERGNATSISEVELKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.