Basic Information | |
---|---|
Taxon OID | 3300005925 Open in IMG/M |
Scaffold ID | Ga0075133_100993 Open in IMG/M |
Source Dataset Name | Saline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome Rauer1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5695 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Haloferacalesvirus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Rauer Lake, Antarctica | |||||||
Coordinates | Lat. (o) | -68.8136 | Long. (o) | 77.9341 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072888 | Metagenome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0075133_10099310 | F072888 | GGA | MTFDVAIEREVNGENELTDYENVSKAINIPSMEKIKLTYPDGETDMSPCGQIVSISEHEASDSEAN* |
⦗Top⦘ |