| Basic Information | |
|---|---|
| Taxon OID | 3300005921 Open in IMG/M |
| Scaffold ID | Ga0070766_10641677 Open in IMG/M |
| Source Dataset Name | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 716 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: New Hampshire, Hubbard Brook experimental Forest | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005483 | Metagenome / Metatranscriptome | 399 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0070766_106416771 | F005483 | GGAGG | MLPLYAARIEDLGPGDFVKIDCAACHHVALLTPEALLRVGLSPAAKLLDLKGRLRCRCCGRKERAVVSVKWRGQRT* |
| ⦗Top⦘ |