NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0070766_10422104

Scaffold Ga0070766_10422104


Overview

Basic Information
Taxon OID3300005921 Open in IMG/M
Scaffold IDGa0070766_10422104 Open in IMG/M
Source Dataset NameWarmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)876
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From The Hubbard Brook Experimental Forest, New Hampshire, Under Manipulated Climate Change Conditions.

Source Dataset Sampling Location
Location NameUSA: New Hampshire, Hubbard Brook experimental Forest
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001528Metagenome / Metatranscriptome677Y
F004392Metagenome / Metatranscriptome440N
F050789Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0070766_104221041F001528AGGAGMSEKNQIVVVLIVALVLGAFVDRITALKIVAGVVLLWTLQNQPAVFECIRKLFSFVQRRPSVREYRGG
Ga0070766_104221042F004392AGGAMPVNGPETLADSKPSQPVPSEGRSVRAARNAKPAVGRGASTRRRRDRQDSSETNGEERFFLASANRNGDVPTLGRECATEAEAIIEAFREKVNLYKVTEFQTRADIGRSGEPILRKETLKKNNPAS*
Ga0070766_104221043F050789N/ALSDGTVGILPLILFAAGILLKPRAVQFIERRRKDRKAETHDGRPHMDAGEQQEIARKETVERCQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.