NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075114_10167502

Scaffold Ga0075114_10167502


Overview

Basic Information
Taxon OID3300005919 Open in IMG/M
Scaffold IDGa0075114_10167502 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKM
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAce Lake, Antarctica
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046310Metagenome / Metatranscriptome151Y

Sequences

Protein IDFamilyRBSSequence
Ga0075114_101675021F046310GGAGMVITVDPGDTTGIAYWTDKGELSEKEALDFDALLEKLELLEGVSVIVYEDYRLRQGKQLVQTGSRFPAVQVIGALKAYAKRHKAKMVRQDASVLTVAALHSGVKRPSDHSKSHSIDAYNHGYYYFETKGLLQPKPL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.