| Basic Information | |
|---|---|
| Taxon OID | 3300005913 Open in IMG/M |
| Scaffold ID | Ga0075108_10016224 Open in IMG/M |
| Source Dataset Name | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2906 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ace Lake, Antarctica | |||||||
| Coordinates | Lat. (o) | -68.4725 | Long. (o) | 78.188 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008154 | Metagenome | 338 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075108_100162244 | F008154 | GAG | MNKDKEEKDLNDCYQELFKTVIDLQARYNNQMIAGTMMAQALRLYKTNLTEEGFRSMVQTIADSGDNIQPFDVPTVN* |
| ⦗Top⦘ |