Scaffold Ga0075111_1001902

Overview

Basic Information

• Taxon OID: 3300005911
• Scaffold ID: Ga0075111_1001902
• Source Dataset Name: Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKK
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9292
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (70.59%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Ace Lake, Antarctica
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056961	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0075111_10019021	F056961	GAG	MNVEHRTSNVEHRIMYSTIYNKDKAKRLPRDVERSMFDVQIVASEITTKPSYHVEIM