NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075132_100555

Scaffold Ga0075132_100555


Overview

Basic Information
Taxon OID3300005907 Open in IMG/M
Scaffold IDGa0075132_100555 Open in IMG/M
Source Dataset NameSaline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome VIRRA1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4419
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Rauer Lake
CoordinatesLat. (o)-68.8136Long. (o)77.9341Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074233Metagenome119N

Sequences

Protein IDFamilyRBSSequence
Ga0075132_1005554F074233N/AMNVTKNKISKFSKIIGIALVAMLAFGGLSGAVSAQEDIGDINVTVEDNGTAVNTQNMTLMDASDNTEVEVLETDSDGFVSFTDISYGEYYLSYTDSQGVTYESATFQTQTGVSLVDWDVDANTLTLEDGSGNLIEEYVGTQDDFVVTDVLSEESNDASTLIGYAGVVVGTVITLIMLIISLIITLRIFRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.