| Basic Information | |
|---|---|
| Taxon OID | 3300005907 Open in IMG/M |
| Scaffold ID | Ga0075132_100055 Open in IMG/M |
| Source Dataset Name | Saline lake microbial communities from Rauer Lake, Antarctica, in enrichment culture - Antartic Rauer Lake 1 Metagenome VIRRA1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 23565 |
| Total Scaffold Genes | 34 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (29.41%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Natrialbales → Natrialbaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Rauer Lake | |||||||
| Coordinates | Lat. (o) | -68.8136 | Long. (o) | 77.9341 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084898 | Metagenome | 112 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075132_10005515 | F084898 | AGG | MSVQYKNSKFKKVTQKDIVSTLETLHGIGQDTAQDVVSLVDAREYEDLLNDDRTDLKANVKRELLKSQINRESVFAVLLYQAQKNNGEEVNLYKKGD* |
| ⦗Top⦘ |