| Basic Information | |
|---|---|
| Taxon OID | 3300005888 Open in IMG/M |
| Scaffold ID | Ga0075289_1007472 Open in IMG/M |
| Source Dataset Name | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1426 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Twitchell Island, California | |||||||
| Coordinates | Lat. (o) | 38.1087 | Long. (o) | -121.653 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011243 | Metagenome / Metatranscriptome | 293 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075289_10074722 | F011243 | GGA | MSVGACSSAGSRLPSPSPDSRFLALRFAAQDATDFGMTDDAVRRFVELRDSGAADAEIAAELRIPGDIVSALVKADEAQALAHRIAAGDEPMYPTPAPEHRVFDTRSGSSAVPLAVLVIVLLGVIVYALVR* |
| ⦗Top⦘ |