NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075292_1020732

Scaffold Ga0075292_1020732


Overview

Basic Information
Taxon OID3300005887 Open in IMG/M
Scaffold IDGa0075292_1020732 Open in IMG/M
Source Dataset NameRice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)866
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: Twitchell Island, California
CoordinatesLat. (o)38.1087Long. (o)-121.653Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031718Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
Ga0075292_10207322F031718N/AEPGVSGAIVRRGGETAVADARGKYRVGGDSGKPVTIDEASLPDGWSSTGAGNGDLGVTLSTSAEIELVVAARSGIAAVQVDLTKARVIARDSAGREWTALMTGPTTATFQALPVGVYKLDFDLSELTEPLVARGPVPALVVSGKDSKSITVTLDPRPIRMWTPPANKSGAQQTTPAPGTSSAATPGRQP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.