NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080455_1154239

Scaffold Ga0080455_1154239


Overview

Basic Information
Taxon OID3300005882 Open in IMG/M
Scaffold IDGa0080455_1154239 Open in IMG/M
Source Dataset NameHydrocarbon microbial community from Halfdan Field MHF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)502
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameHalfdan Field, North Sea, Denmark
CoordinatesLat. (o)55.49Long. (o)7.42Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004971Metagenome416Y

Sequences

Protein IDFamilyRBSSequence
Ga0080455_11542391F004971GAGGMVERKMVERKMSEKGVIKLGNLDVFEDGWFEALKALAIQKISEATGEPAKFAMGFCDVDEALHVVTASGRVFHVSYSDVMDVFAIEEVQCPRCGDYVPVDILEEHEELCSE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.