Basic Information | |
---|---|
Taxon OID | 3300005882 Open in IMG/M |
Scaffold ID | Ga0080455_1072391 Open in IMG/M |
Source Dataset Name | Hydrocarbon microbial community from Halfdan Field MHF |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1036 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Halfdan Field, North Sea, Denmark | |||||||
Coordinates | Lat. (o) | 55.49 | Long. (o) | 7.42 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002709 | Metagenome | 535 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0080455_10723912 | F002709 | N/A | MQKVLADFIKVNRQLMIDLSMSENANLLHGRDYSLHVTQKLGAKIDSQLVKEKLGEIAYHQCKVPTQYKQIQAMPLSETTVSRNKKATIDEVADFRISA* |
⦗Top⦘ |