NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080455_1072347

Scaffold Ga0080455_1072347


Overview

Basic Information
Taxon OID3300005882 Open in IMG/M
Scaffold IDGa0080455_1072347 Open in IMG/M
Source Dataset NameHydrocarbon microbial community from Halfdan Field MHF
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1036
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameHalfdan Field, North Sea, Denmark
CoordinatesLat. (o)55.49Long. (o)7.42Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019652Metagenome / Metatranscriptome228N
F084260Metagenome / Metatranscriptome112N

Sequences

Protein IDFamilyRBSSequence
Ga0080455_10723471F019652N/ADLIKDMAKKEKALIEFQQKKHSVENDLRNKAQVIADQISEIFNNTIKRNKWDMNRINIDIHDDKDAVDYITKKIKKACYEEAEVQARAKHQLYHALENKKKKCLNILYTGSHIQPTLVELQKEMATANIQLDLPNSLLALPSK*
Ga0080455_10723472F084260N/AMEILFALGLFVIIGVGLWLMRETDKFVDEHNRQIRLQRACDQVDKIVKQKQMEFKFDK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.