NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075287_1000143

Scaffold Ga0075287_1000143


Overview

Basic Information
Taxon OID3300005873 Open in IMG/M
Scaffold IDGa0075287_1000143 Open in IMG/M
Source Dataset NameRice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8393
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (72.73%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: Twitchell Island, California
CoordinatesLat. (o)38.1087Long. (o)-121.653Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075801Metagenome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0075287_10001434F075801GGAGGMPHVPLPALTPEQWESGDYRQPARDLDSWAKTQPAARDDDATEYVAKLGLDHAGSVLAMNRAHDRVLVPPPARAPLAAFALAGQPFGFTAADVAAVETAAGRTDDPGTRHALRDLGQRIQSLLPPAGVTKESLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.