Scaffold Ga0058710_1000710

Overview

Basic Information

• Taxon OID: 3300005872
• Scaffold ID: Ga0058710_1000710
• Source Dataset Name: Bulk soil microbial communities from Harvard Forest, USA - 3Bulk_unsorted metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 925
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location

• Location Name: Harvard Forest, Massachusetts, USA
• Coordinates
  • Lat. (^o): 42.5502
  • Long. (^o): -72.1737

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027788	Metagenome / Metatranscriptome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0058710_10007101	F027788	GGAG	MTTVGSSAADALLGAVAVTLLVVMYGQWLYRSRRLRRCQERLRVVRELIADGERTKTAYADASDASAAHGGFLQRCDSSLRDQFGDSFARRIAAYSEFEWIQPASLISNEQVFAWYDTERRLAGLRELLYEALLDLGEASLDLGSLVE*