Scaffold Ga0056124_1015393

Overview

Basic Information

• Taxon OID: 3300005871
• Scaffold ID: Ga0056124_1015393
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius sp. 4 HERON ISLAND
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4080
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Germany: Marburg
• Coordinates
  • Lat. (^o): 50.8
  • Long. (^o): 8.81

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007069	Metagenome	358	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0056124_10153936	F007069	AGGA	MPDGSEFQTAGAATQKPREAKVVRTRGADNRLVFAERRPRVGVW*