NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080004_1216004

Scaffold Ga0080004_1216004


Overview

Basic Information
Taxon OID3300005860 Open in IMG/M
Scaffold IDGa0080004_1216004 Open in IMG/M
Source Dataset NameSulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1497
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameWashburn Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011097Metagenome / Metatranscriptome295Y

Sequences

Protein IDFamilyRBSSequence
Ga0080004_12160041F011097AGAAGGMIRDIPLYTSGGGDPFTGLPVGGSPITGGGSNSQILGFNPKYARLIILVSSLSGASPSIQFTVGSPYGSNFYNINTASSPVYIYVVGKDNKTTIVFLNTSWQVVQQVELPYNIFFNGVSISWSVSGSSPSIGAYIHYEFEDDGEEE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.