| Basic Information | |
|---|---|
| Taxon OID | 3300005860 Open in IMG/M |
| Scaffold ID | Ga0080004_1117716 Open in IMG/M |
| Source Dataset Name | Sulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS (SPADES assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 15254 |
| Total Scaffold Genes | 18 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (77.78%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Washburn Spring, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019254 | Metagenome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0080004_111771615 | F019254 | AGG | MPSEKIQEALSHLQDDWPLRVLLSALAEGVAELTALLGKAEAQKLPPEFLTRIRAIEEEMHALSRLRQNPPLPRMGNRRKVGNLPLF* |
| ⦗Top⦘ |