NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080008_147162

Scaffold Ga0080008_147162


Overview

Basic Information
Taxon OID3300005854 Open in IMG/M
Scaffold IDGa0080008_147162 Open in IMG/M
Source Dataset NameHot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - CON_C (SPADES assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2247
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameConch Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021443Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0080008_1471623F021443N/AMKYLLNDDKLTFIFKSSYVTCHNYGYGYYQTNGIFSFAVMDLAFRIIKQQKRKSIILKKRKPIIHLINYIDTLNFNYISNKFDITFPLKNDYKTQLIYNLYLYRCLYRREYYKDFYKDSLIVIERENSYTIRTEYDYANRIQPKNLDLATMLIHILEKEGINTINGDGIIFYCVFLM*
Ga0080008_1471624F021443N/AMKWLLNGEKLTFIFDYSYIECHNLDYGYYQTNRILSFAVIDLAFKIINQQKRKSIILKKRKPIIHLLNYIDILNFNFNSNKFDVTFPLKNNYEPQLTHNLYLYRSLYRREYYKDFYKDGLKVIESKNLCIIRLEYDYASRIQPRNLNLVTMLMHILEKKEVDMIDVSSIIFYCIFLM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.