Scaffold Ga0078893_10785143

Overview

Basic Information

• Taxon OID: 3300005837
• Scaffold ID: Ga0078893_10785143
• Source Dataset Name: Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Australian Centre for Ecogenomics
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6122
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula → unclassified Rhodopirellula → Rhodopirellula sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location

• Location Name: Port Hacking, Australia
• Coordinates
  • Lat. (^o): -34.1192
  • Long. (^o): 151.2267
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087732	Metagenome / Metatranscriptome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0078893_107851432	F087732	AGGAG	MPLYGKYKQGDLGMEDETKLSREKLESWVKTKYSHAEESSVNEASLSGKNQIDSNFMALADEKDY*