| Basic Information | |
|---|---|
| Taxon OID | 3300005836 Open in IMG/M |
| Scaffold ID | Ga0074470_11310202 Open in IMG/M |
| Source Dataset Name | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 766 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Astoria, Oregon, USA | |||||||
| Coordinates | Lat. (o) | 46.15968 | Long. (o) | -123.80651 | Alt. (m) | Depth (m) | .06 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051046 | Metagenome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074470_113102021 | F051046 | N/A | EAAMYWGHGLGFLAGLIWLAVVIYLLTLAARFVRAIERIADRTETKPT* |
| ⦗Top⦘ |