Scaffold Ga0074470_10490124

Overview

Basic Information

• Taxon OID: 3300005836
• Scaffold ID: Ga0074470_10490124
• Source Dataset Name: Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 580
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Astoria, Oregon, USA
• Coordinates
  • Lat. (^o): 46.15968
  • Long. (^o): -123.80651
  • Depth (m): .06

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026969	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074470_104901242	F026969	N/A	VDWAVHPITRIEVSGPMGEGPACAMHLLALQTYRPRKAVVRRAAGRPSATVCVGTTCSLPVSTPAALRELLA*