| Basic Information | |
|---|---|
| Taxon OID | 3300005835 Open in IMG/M |
| Scaffold ID | Ga0078910_115441 Open in IMG/M |
| Source Dataset Name | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwegian Sequencing Centre (NSC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1198 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alnarp, Sweden | |||||||
| Coordinates | Lat. (o) | 59.8152338 | Long. (o) | 17.6620518 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014634 | Metagenome / Metatranscriptome | 261 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078910_1154411 | F014634 | AGGAGG | MKERIKEVFNLEWIKNFVEKNIEFTEWIEEECGEKRRILVIETLVSSQHGAYIPGLVLEMFGQAEGYDLENPYNYDKNETIHDALMFWENKISDELNELLPSKGIYYVGYHEYDGSYCLFYEEYEEGEEE* |
| ⦗Top⦘ |