NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078910_102551

Scaffold Ga0078910_102551


Overview

Basic Information
Taxon OID3300005835 Open in IMG/M
Scaffold IDGa0078910_102551 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7940
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities

Source Dataset Sampling Location
Location NameAlnarp, Sweden
CoordinatesLat. (o)59.8152338Long. (o)17.6620518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054061Metagenome / Metatranscriptome140Y
F067884Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0078910_10255110F067884N/AMCRARSTRYQVTRSPATRLAAGWNGSPALARQAQKFVLYDEDQVMMLKIVTETVRVSDSAAEYDRGTVGRKPESRVGLARADFAETDWVHA*
Ga0078910_1025515F054061GGAGMDDETFEIIKAGAADAPPEQALYRIQHTYSDGSGARLNVDWEGLHRLHDLIPRNDRVRGACL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.