NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078910_101072

Scaffold Ga0078910_101072


Overview

Basic Information
Taxon OID3300005835 Open in IMG/M
Scaffold IDGa0078910_101072 Open in IMG/M
Source Dataset NameBiogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNorwegian Sequencing Centre (NSC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4410
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor → Biogas Reactor Microbial Communities

Source Dataset Sampling Location
Location NameAlnarp, Sweden
CoordinatesLat. (o)59.8152338Long. (o)17.6620518Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079824Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0078910_1010722F079824AGGAGGMIYGFFGSIPGCPHQRGHHALRGNGKTLCLTFVGYLDHLSGRDVISNYKTSFSEFVSTERIAEMVIYEDIRDTTILLSELQLYMNSLGVNTKELRSFVGSVIGQSRKRNTDIHYDTQRYTDVHPRIRVQTDRAFLPRKFHADDKPCQLDRCEKKHFIYLYQHDPYMEHPIVKLRADKFGVLYDTNEIVALIKD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.