NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074472_11451155

Scaffold Ga0074472_11451155


Overview

Basic Information
Taxon OID3300005833 Open in IMG/M
Scaffold IDGa0074472_11451155 Open in IMG/M
Source Dataset NameMicrobial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon Health and Science University (OHSU)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1141
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameCathlamet Bay
CoordinatesLat. (o)46.18749Long. (o)-123.58892Alt. (m)Depth (m).02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003559Metagenome / Metatranscriptome479Y

Sequences

Protein IDFamilyRBSSequence
Ga0074472_114511552F003559AGGAGMSLYDGRPWGDDGDLPWDSPDEEWEPADSEAWRGDLHLDDWPENLAGPEYWLYKKQQGDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.