| Basic Information | |
|---|---|
| Taxon OID | 3300005832 Open in IMG/M |
| Scaffold ID | Ga0074469_10568540 Open in IMG/M |
| Source Dataset Name | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9902 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (45.45%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ilwaco, Washington, USA | |||||||
| Coordinates | Lat. (o) | 46.28551 | Long. (o) | -124.05187 | Alt. (m) | Depth (m) | .06 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025314 | Metagenome | 202 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074469_105685404 | F025314 | GGAGG | MGLLNRKFPAFSLEFVGEEIRSMINPELAQDMDVLCDVIVYMEYSLHSMQKIVQINHAEDKLAKCREDIQNTEWWKEKQSLVNSAKTIEDVWPFLKKKDI* |
| ⦗Top⦘ |