| Basic Information | |
|---|---|
| Taxon OID | 3300005831 Open in IMG/M |
| Scaffold ID | Ga0074471_11103695 Open in IMG/M |
| Source Dataset Name | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1368 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Astoria, Oregon, USA | |||||||
| Coordinates | Lat. (o) | 46.17469 | Long. (o) | -123.84933 | Alt. (m) | Depth (m) | .06 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F017846 | Metagenome / Metatranscriptome | 238 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074471_111036952 | F017846 | N/A | MPTQFKIAITKEIIAQSRFCGTGDEPRRIENNCAIAVALADIFPKAYVTNQCIFPFGVDGDQEKDIKIPLPLIAQQFIKLFDGFRLTPGLRLMLPAFEFIIDIPDEVVEQINIDEVKVLIEKNITGSLHTVSYPAVAEARRMM* |
| ⦗Top⦘ |