| Basic Information | |
|---|---|
| Taxon OID | 3300005829 Open in IMG/M |
| Scaffold ID | Ga0074479_11016311 Open in IMG/M |
| Source Dataset Name | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4567 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cathlamet Bay | |||||||
| Coordinates | Lat. (o) | 46.208333 | Long. (o) | -123.6925 | Alt. (m) | Depth (m) | .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F048399 | Metagenome / Metatranscriptome | 148 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074479_110163112 | F048399 | AGGAGG | MNPGIRVRNRLNVLLQMITALITAILLGQLWLFTVTLEAMENGAVSGTVAVAATVCSLVACSSIWMLIRFFLRTEQSETGERL* |
| ⦗Top⦘ |