Scaffold Ga0074479_10305504

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074479_10305504

Scaffold Ga0074479_10305504

Overview

Basic Information
Taxon OID	3300005829 Open in IMG/M
Scaffold ID	Ga0074479_10305504 Open in IMG/M
Source Dataset Name	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon Health and Science University (OHSU)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	678
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Cathlamet Bay
Coordinates	Lat. (^o)	46.208333	Long. (^o)	-123.6925	Alt. (m)		Depth (m)	.02
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056331	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074479_103055042	F056331	GAG	MLKRVMRSGCVSCVHRVFLHASVVYVACGIEILDVLDIKIRVATLVRESTYLRSSHGSRRRSASRYLPRTRVRDTHY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.