| Basic Information | |
|---|---|
| Taxon OID | 3300005829 Open in IMG/M |
| Scaffold ID | Ga0074479_10249745 Open in IMG/M |
| Source Dataset Name | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon Health and Science University (OHSU) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 15444 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (43.75%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cathlamet Bay | |||||||
| Coordinates | Lat. (o) | 46.208333 | Long. (o) | -123.6925 | Alt. (m) | Depth (m) | .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F042053 | Metagenome / Metatranscriptome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0074479_1024974515 | F042053 | GAGG | MSVKSQLNASRDFILTGMRAAARVETANPNATKILRGCLDLIETLVRQPQENVTMMDIETTLNVLHQSMTEIDDETSATSAFVSSIQNAAGRLQDLRRELAASK* |
| ⦗Top⦘ |