Scaffold Ga0074477_1759628

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0074477_1759628

Scaffold Ga0074477_1759628

Overview

Basic Information
Taxon OID	3300005826 Open in IMG/M
Scaffold ID	Ga0074477_1759628 Open in IMG/M
Source Dataset Name	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon Health and Science University (OHSU)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	682
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Ilwaco, Washington, USA
Coordinates	Lat. (^o)	46.31286	Long. (^o)	-123.99663	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028500	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074477_17596283	F028500	N/A	MGADMYEIRTKWSNMVVYRTTERGNAVFWLENNNQEGVFKLVKVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.