Scaffold Ga0074477_1295439

Overview

Basic Information

• Taxon OID: 3300005826
• Scaffold ID: Ga0074477_1295439
• Source Dataset Name: Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon Health and Science University (OHSU)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2610
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (10.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Ilwaco, Washington, USA
• Coordinates
  • Lat. (^o): 46.31286
  • Long. (^o): -123.99663

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056618	Metagenome / Metatranscriptome	137	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074477_12954398	F056618	N/A	MEDPYRITVEQYDYKYSVEINHSYIDFTEYIELLRQISLAAGWDINEVKEFFDK*