| Basic Information | |
|---|---|
| Taxon OID | 3300005820 Open in IMG/M |
| Scaffold ID | Ga0078747_128006 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Aarhus University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1301 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Aarhus Bay station M5 | |||||||
| Coordinates | Lat. (o) | 56.10555 | Long. (o) | 10.463333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011087 | Metagenome | 295 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0078747_1280062 | F011087 | N/A | MSDYIKGNKYPNSKPSTSYSSGRVCVHKECDTVISKYNKFKYCNKHKPRSYPRIKGRQSPTGLQDPIN* |
| ⦗Top⦘ |