Scaffold Ga0078747_104192

Overview

Basic Information

• Taxon OID: 3300005820
• Scaffold ID: Ga0078747_104192
• Source Dataset Name: Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 75 cmbsf, PM2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Aarhus University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4027
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location

• Location Name: Aarhus Bay station M5
• Coordinates
  • Lat. (^o): 56.10555
  • Long. (^o): 10.463333

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048391	Metagenome / Metatranscriptome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078747_1041922	F048391	AGG	MNDSKTVGPINNLDYLEELLNEGYNIKGPRTSKDPEADPRRDLISFKAFLKKGKEFAPEDWLSSMGYKFVEPNTFTQGHRIAYKIIDEFPDERFKSSYSLLKEGKEIPLYLKVELPKLE*