Scaffold Ga0079971_105786

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079971_105786

Scaffold Ga0079971_105786

Overview

Basic Information
Taxon OID	3300005807 Open in IMG/M
Scaffold ID	Ga0079971_105786 Open in IMG/M
Source Dataset Name	Basalt sediment microbial communities from Loihi, Hawaii, USA - Two Loihi Rocks
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	619
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From Loihi, Hawaii, Usa

Source Dataset Sampling Location
Location Name	Lo'ihi Seamount, Hawai'I
Coordinates	Lat. (^o)	18.92	Long. (^o)	-155.27	Alt. (m)		Depth (m)	5000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043695	Metagenome	156	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079971_1057862	F043695	AGG	MTLSAGTGFNAIGREIFGFAPQIDFXAXXTNTDRTAXDXTSPLQLYMCEMLPAXNTSGMAAGDILSFSLQGNGLAIFQSKFALAAASEPIQAQLPTIKFILPARTILKAVFNMQSGTXMXGSATCMXXGVXFA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.