| Basic Information | |
|---|---|
| Taxon OID | 3300005807 Open in IMG/M |
| Scaffold ID | Ga0079971_102977 Open in IMG/M |
| Source Dataset Name | Basalt sediment microbial communities from Loihi, Hawaii, USA - Two Loihi Rocks |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 665 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From Loihi, Hawaii, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lo'ihi Seamount, Hawai'I | |||||||
| Coordinates | Lat. (o) | 18.92 | Long. (o) | -155.27 | Alt. (m) | Depth (m) | 5000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F106170 | Metagenome | 100 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079971_1029771 | F106170 | N/A | PALKEGDALTFQLNDIGVDVDTEFGEKLQFSLRVINTAVSSSSSIKEGTYIWNTTCRAAKDLHEYFIDQDMETCSWTFVLES* |
| ⦗Top⦘ |