Scaffold Ga0079971_102512

Overview

Basic Information

• Taxon OID: 3300005807
• Scaffold ID: Ga0079971_102512
• Source Dataset Name: Basalt sediment microbial communities from Loihi, Hawaii, USA - Two Loihi Rocks
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1457
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Benthic → Basalt Sediment → Basalt Sediment Microbial Communities From Loihi, Hawaii, Usa

Source Dataset Sampling Location

• Location Name: Lo'ihi Seamount, Hawai'I
• Coordinates
  • Lat. (^o): 18.92
  • Long. (^o): -155.27
  • Depth (m): 5000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030294	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079971_1025124	F030294	GAG	MAAGFSLVDDLNAGDVVGKALGGNLSQALNGLSANAQGLXKTDAGRKSLVQAVGIAAIGAWARKALPATKIGGTKLYFRI*