Scaffold Ga0079957_1254323

Overview

Basic Information

• Taxon OID: 3300005805
• Scaffold ID: Ga0079957_1254323
• Source Dataset Name: Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Oregon State University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 813
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Mergibacter → Mergibacter septicus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location

• Location Name: Wichita, Kansas, USA
• Coordinates
  • Lat. (^o): 37.7330997
  • Long. (^o): -97.7990663

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045622	Metagenome / Metatranscriptome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079957_12543232	F045622	N/A	KIKKPKMKQLLEMLPKILGMMPEIVKYIKYIPIIMGLAGIGYGVYYVTKNYKDPYMCYENEIYEQISVTSSVYKFKGGYCISDK*