Scaffold Ga0079957_1096964

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079957_1096964

Scaffold Ga0079957_1096964

Overview

Basic Information
Taxon OID	3300005805 Open in IMG/M
Scaffold ID	Ga0079957_1096964 Open in IMG/M
Source Dataset Name	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1619
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location
Location Name	Wichita, Kansas, USA
Coordinates	Lat. (^o)	37.7330997	Long. (^o)	-97.7990663	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100688	Metagenome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0079957_10969643	F100688	GGAGG	MIDPGDEHQERDILHRLDVVWEGMGEMALDERREAAREIRALRDEVRRLRAVLPMHIHRIMYETEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.