Basic Information | |
---|---|
Taxon OID | 3300005805 Open in IMG/M |
Scaffold ID | Ga0079957_1085442 Open in IMG/M |
Source Dataset Name | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Oregon State University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1768 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ichthyostraca → Branchiura → Arguloida → Argulidae → Argulus → Argulus foliaceus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Wichita, Kansas, USA | |||||||
Coordinates | Lat. (o) | 37.7330997 | Long. (o) | -97.7990663 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F009426 | Metagenome / Metatranscriptome | 318 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079957_10854422 | F009426 | N/A | MAAKVNKDVKPSSSMVLREILYTMSLFMTTSPCVTNAVAARETLFEGKADYCMVVCE* |
⦗Top⦘ |