NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0079957_1079496

Scaffold Ga0079957_1079496


Overview

Basic Information
Taxon OID3300005805 Open in IMG/M
Scaffold IDGa0079957_1079496 Open in IMG/M
Source Dataset NameMicrobial and algae communities from Cheney Reservoir in Wichita, Kansas, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1859
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa

Source Dataset Sampling Location
Location NameWichita, Kansas, USA
CoordinatesLat. (o)37.7330997Long. (o)-97.7990663Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022160Metagenome / Metatranscriptome215Y

Sequences

Protein IDFamilyRBSSequence
Ga0079957_10794962F022160N/AVIKLTQEGADYAFEYAWELAQVTGPVAGLYSLVINHGLGFRPNVTVKTSAGDVLETGIDYNSSNQLTLTMAQPFSGTAYLS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.