| Basic Information | |
|---|---|
| Taxon OID | 3300005805 Open in IMG/M |
| Scaffold ID | Ga0079957_1068941 Open in IMG/M |
| Source Dataset Name | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2053 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake → Microbial And Algae Communities From Cheney Reservoir In Wichita, Kansas, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Wichita, Kansas, USA | |||||||
| Coordinates | Lat. (o) | 37.7330997 | Long. (o) | -97.7990663 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041770 | Metagenome | 159 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079957_10689416 | F041770 | AGGAG | MKTESVGADILLEAHQLVKGPRNNDYGNVVDDYTKVISIFESLTGIKLSMSDALLFMVSIKMARLRTNLERNRLHHDSLLDALGYLGLLNQAYNDLPFPRTVAER* |
| ⦗Top⦘ |