Scaffold Ga0078393_138850

Overview

Basic Information

• Taxon OID: 3300005777
• Scaffold ID: Ga0078393_138850
• Source Dataset Name: Human lung microbial communities from Normal Smoker Supraglottic 110406-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: New York University Langone Medical Center
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1193
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome → Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects

Source Dataset Sampling Location

• Location Name: New York City, New York, USA
• Coordinates
  • Lat. (^o): 40.7127
  • Long. (^o): -74.0059

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054110	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0078393_1388502	F054110	N/A	MNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD*