| Basic Information | |
|---|---|
| Taxon OID | 3300005764 Open in IMG/M |
| Scaffold ID | Ga0066903_108092707 Open in IMG/M |
| Source Dataset Name | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 539 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Panama: Oeste | |||||||
| Coordinates | Lat. (o) | 9.1086 | Long. (o) | -79.8436 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009975 | Metagenome / Metatranscriptome | 310 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066903_1080927071 | F009975 | N/A | VAGLFSVLAAANAQPPPAAAGGGSYDGNYRLVSSANVNTTYTTRKGQTAPCPGRRAGPLHITNGQARYTTATGLKVRGTLGPQGELVMQAVAPSTWGTQPIDLSVNGTVDASGTAHVRQLSHSCSYDFVWQKAAR* |
| ⦗Top⦘ |