NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0078117_1058710

Scaffold Ga0078117_1058710


Overview

Basic Information
Taxon OID3300005758 Open in IMG/M
Scaffold IDGa0078117_1058710 Open in IMG/M
Source Dataset NameCyanobacteria communities in tropical freswater systems - freshwater lake in Singapore
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4778
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (8.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.411221Long. (o)103.905587Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080003Metagenome115Y

Sequences

Protein IDFamilyRBSSequence
Ga0078117_10587102F080003N/AMAKPPFVPGTVYYGTLTCAHSDFPVRCVRRTDKSVWFEHVTHPNVYGTGRCKIRKWDDGSESAMFRRWYVSSDKTTGGDFDPLTI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.