Scaffold Ga0078117_1004050

Overview

Basic Information

• Taxon OID: 3300005758
• Scaffold ID: Ga0078117_1004050
• Source Dataset Name: Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 10147
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.411221
  • Long. (^o): 103.905587

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004206	Metagenome / Metatranscriptome	448	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0078117_10040505	F004206	N/A	MIKEITDYLLARLPDSFRGWTREAVEDYVLFHAEQGTLKIACQDDHVVAVLVGWRQLSPNPQPWAWQASDPEGDHWYWHQFAADSAVFAMAVAAKFFHDRPEAAILPAIGYRNGKLTTYKKGSMPIYRVASKMI*