Basic Information | |
---|---|
Taxon OID | 3300005758 Open in IMG/M |
Scaffold ID | Ga0078117_1000538 Open in IMG/M |
Source Dataset Name | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 60088 |
Total Scaffold Genes | 99 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 63 (63.64%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water → Cyanobacterial Bloom Metagenomics Project |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.411221 | Long. (o) | 103.905587 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032284 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0078117_100053813 | F032284 | N/A | MCEMMGTEPIDSEIPVDFEDFPLEVQQAFVVYRMLRDEWDTMNGNYLGKSLIGIKDLLEAAEIDPSEYKLTIMLVRMIDDVRSEEINKKLREKPAV* |
⦗Top⦘ |